Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097
  1. Avatar for Hellcat6 21. Hellcat6 Lv 1 44 pts. 10,087
  2. Avatar for DoctorSockrates 22. DoctorSockrates Lv 1 42 pts. 10,083
  3. Avatar for georg137 23. georg137 Lv 1 40 pts. 10,078
  4. Avatar for boondog 24. boondog Lv 1 38 pts. 10,069
  5. Avatar for robgee 25. robgee Lv 1 36 pts. 10,056
  6. Avatar for crpainter 26. crpainter Lv 1 35 pts. 10,040
  7. Avatar for Glen B 27. Glen B Lv 1 33 pts. 10,034
  8. Avatar for pvc78 28. pvc78 Lv 1 31 pts. 10,034
  9. Avatar for orily1337 29. orily1337 Lv 1 30 pts. 10,021
  10. Avatar for nicobul 30. nicobul Lv 1 28 pts. 10,015

Comments