Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,926
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 9,895
  3. Avatar for freefolder 13. freefolder 1 pt. 9,313
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,276
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,265
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 8,537
  1. Avatar for Tlaloc 81. Tlaloc Lv 1 1 pt. 9,276
  2. Avatar for kludbrook 82. kludbrook Lv 1 1 pt. 9,272
  3. Avatar for alwan2018 83. alwan2018 Lv 1 1 pt. 9,265
  4. Avatar for Lyshi2018 84. Lyshi2018 Lv 1 1 pt. 9,238
  5. Avatar for Knoblerine 85. Knoblerine Lv 1 1 pt. 9,218
  6. Avatar for MrZanav 86. MrZanav Lv 1 1 pt. 9,202
  7. Avatar for hajtogato 87. hajtogato Lv 1 1 pt. 9,195
  8. Avatar for kvasirthewise 88. kvasirthewise Lv 1 1 pt. 9,193
  9. Avatar for ehhan2018 89. ehhan2018 Lv 1 1 pt. 9,151
  10. Avatar for Znaika 90. Znaika Lv 1 1 pt. 9,148

Comments