Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups


  1. Avatar for Beta Folders 100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097

  1. Avatar for Tlaloc 81. Tlaloc Lv 1 1 pt. 9,276
  2. Avatar for kludbrook 82. kludbrook Lv 1 1 pt. 9,272
  3. Avatar for alwan2018 83. alwan2018 Lv 1 1 pt. 9,265
  4. Avatar for Lyshi2018 84. Lyshi2018 Lv 1 1 pt. 9,238
  5. Avatar for Knoblerine 85. Knoblerine Lv 1 1 pt. 9,218
  6. Avatar for MrZanav 86. MrZanav Lv 1 1 pt. 9,202
  7. Avatar for hajtogato 87. hajtogato Lv 1 1 pt. 9,195
  8. Avatar for kvasirthewise 88. kvasirthewise Lv 1 1 pt. 9,193
  9. Avatar for ehhan2018 89. ehhan2018 Lv 1 1 pt. 9,151
  10. Avatar for Znaika 90. Znaika Lv 1 1 pt. 9,148

Comments