Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,331
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,967
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,798
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,666
  5. Avatar for BIOF215 15. BIOF215 1 pt. 6,809
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 5,891
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 5,884
  1. Avatar for Lyshi2018 101. Lyshi2018 Lv 1 1 pt. 8,666
  2. Avatar for rezaefar 102. rezaefar Lv 1 1 pt. 8,658
  3. Avatar for alwan2018 103. alwan2018 Lv 1 1 pt. 8,648
  4. Avatar for ehhan2018 104. ehhan2018 Lv 1 1 pt. 8,640
  5. Avatar for nong9090 105. nong9090 Lv 1 1 pt. 8,570
  6. Avatar for RockOn 106. RockOn Lv 1 1 pt. 8,567
  7. Avatar for utils 107. utils Lv 1 1 pt. 8,566
  8. Avatar for ViJay7019 108. ViJay7019 Lv 1 1 pt. 8,463
  9. Avatar for thel0lminecrafter 109. thel0lminecrafter Lv 1 1 pt. 8,312
  10. Avatar for YGK 110. YGK Lv 1 1 pt. 8,072

Comments