Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202
  1. Avatar for Lyshi2018 101. Lyshi2018 Lv 1 1 pt. 8,666
  2. Avatar for rezaefar 102. rezaefar Lv 1 1 pt. 8,658
  3. Avatar for alwan2018 103. alwan2018 Lv 1 1 pt. 8,648
  4. Avatar for ehhan2018 104. ehhan2018 Lv 1 1 pt. 8,640
  5. Avatar for nong9090 105. nong9090 Lv 1 1 pt. 8,570
  6. Avatar for RockOn 106. RockOn Lv 1 1 pt. 8,567
  7. Avatar for utils 107. utils Lv 1 1 pt. 8,566
  8. Avatar for ViJay7019 108. ViJay7019 Lv 1 1 pt. 8,463
  9. Avatar for thel0lminecrafter 109. thel0lminecrafter Lv 1 1 pt. 8,312
  10. Avatar for YGK 110. YGK Lv 1 1 pt. 8,072

Comments