Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,331
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,967
  3. Avatar for DW 2020 14. DW 2020 1 pt. 8,666
  4. Avatar for BIOF215 15. BIOF215 1 pt. 6,809
  5. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 5,891
  6. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 5,884

  1. Avatar for vakobo 11. vakobo Lv 1 74 pts. 10,380
  2. Avatar for Mark- 12. Mark- Lv 1 71 pts. 10,365
  3. Avatar for reefyrob 13. reefyrob Lv 1 69 pts. 10,354
  4. Avatar for fiendish_ghoul 14. fiendish_ghoul Lv 1 67 pts. 10,338
  5. Avatar for Timo van der Laan 15. Timo van der Laan Lv 1 65 pts. 10,323
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 62 pts. 10,304
  7. Avatar for nicobul 17. nicobul Lv 1 60 pts. 10,304
  8. Avatar for johnmitch 18. johnmitch Lv 1 58 pts. 10,290
  9. Avatar for hpaege 19. hpaege Lv 1 56 pts. 10,279
  10. Avatar for gdnskye 20. gdnskye Lv 1 55 pts. 10,244

Comments