Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202
  1. Avatar for vakobo 11. vakobo Lv 1 74 pts. 10,380
  2. Avatar for Mark- 12. Mark- Lv 1 71 pts. 10,365
  3. Avatar for reefyrob 13. reefyrob Lv 1 69 pts. 10,354
  4. Avatar for fiendish_ghoul 14. fiendish_ghoul Lv 1 67 pts. 10,338
  5. Avatar for Timo van der Laan 15. Timo van der Laan Lv 1 65 pts. 10,323
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 62 pts. 10,304
  7. Avatar for nicobul 17. nicobul Lv 1 60 pts. 10,304
  8. Avatar for johnmitch 18. johnmitch Lv 1 58 pts. 10,290
  9. Avatar for hpaege 19. hpaege Lv 1 56 pts. 10,279
  10. Avatar for gdnskye 20. gdnskye Lv 1 55 pts. 10,244

Comments