Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,331
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,967
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,798
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,666
  5. Avatar for BIOF215 15. BIOF215 1 pt. 6,809
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 5,891
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 5,884
  1. Avatar for Sissue 31. Sissue Lv 1 37 pts. 10,089
  2. Avatar for MicElephant 32. MicElephant Lv 1 36 pts. 10,085
  3. Avatar for jobo0502 33. jobo0502 Lv 1 34 pts. 10,083
  4. Avatar for isaksson 34. isaksson Lv 1 33 pts. 10,080
  5. Avatar for Aminal88 35. Aminal88 Lv 1 32 pts. 10,045
  6. Avatar for Skippysk8s 36. Skippysk8s Lv 1 31 pts. 10,012
  7. Avatar for pvc78 37. pvc78 Lv 1 29 pts. 10,003
  8. Avatar for tarimo 38. tarimo Lv 1 28 pts. 10,002
  9. Avatar for georg137 39. georg137 Lv 1 27 pts. 9,997
  10. Avatar for silent gene 40. silent gene Lv 1 26 pts. 9,968

Comments