Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202
  1. Avatar for Sissue 31. Sissue Lv 1 37 pts. 10,089
  2. Avatar for MicElephant 32. MicElephant Lv 1 36 pts. 10,085
  3. Avatar for jobo0502 33. jobo0502 Lv 1 34 pts. 10,083
  4. Avatar for isaksson 34. isaksson Lv 1 33 pts. 10,080
  5. Avatar for Aminal88 35. Aminal88 Lv 1 32 pts. 10,045
  6. Avatar for Skippysk8s 36. Skippysk8s Lv 1 31 pts. 10,012
  7. Avatar for pvc78 37. pvc78 Lv 1 29 pts. 10,003
  8. Avatar for tarimo 38. tarimo Lv 1 28 pts. 10,002
  9. Avatar for georg137 39. georg137 Lv 1 27 pts. 9,997
  10. Avatar for silent gene 40. silent gene Lv 1 26 pts. 9,968

Comments