Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,331
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,967
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,798
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,666
  5. Avatar for BIOF215 15. BIOF215 1 pt. 6,809
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 5,891
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 5,884
  1. Avatar for Vinara 41. Vinara Lv 1 25 pts. 9,960
  2. Avatar for dizzywings 42. dizzywings Lv 1 24 pts. 9,957
  3. Avatar for WBarme1234 43. WBarme1234 Lv 1 23 pts. 9,943
  4. Avatar for Mike Cassidy 44. Mike Cassidy Lv 1 22 pts. 9,925
  5. Avatar for manu8170 45. manu8170 Lv 1 21 pts. 9,903
  6. Avatar for benrh 46. benrh Lv 1 21 pts. 9,896
  7. Avatar for Deleted player 47. Deleted player 20 pts. 9,889
  8. Avatar for alwen 48. alwen Lv 1 19 pts. 9,849
  9. Avatar for Marvelz 49. Marvelz Lv 1 18 pts. 9,845
  10. Avatar for spvincent 50. spvincent Lv 1 17 pts. 9,830

Comments