Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202
  1. Avatar for Vinara 41. Vinara Lv 1 25 pts. 9,960
  2. Avatar for dizzywings 42. dizzywings Lv 1 24 pts. 9,957
  3. Avatar for WBarme1234 43. WBarme1234 Lv 1 23 pts. 9,943
  4. Avatar for Mike Cassidy 44. Mike Cassidy Lv 1 22 pts. 9,925
  5. Avatar for manu8170 45. manu8170 Lv 1 21 pts. 9,903
  6. Avatar for benrh 46. benrh Lv 1 21 pts. 9,896
  7. Avatar for Deleted player 47. Deleted player 20 pts. 9,889
  8. Avatar for alwen 48. alwen Lv 1 19 pts. 9,849
  9. Avatar for Marvelz 49. Marvelz Lv 1 18 pts. 9,845
  10. Avatar for spvincent 50. spvincent Lv 1 17 pts. 9,830

Comments