Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Richard Dawkins Foundation 21. Richard Dawkins Foundation 1 pt. 8,439
  2. Avatar for Dutch Power Cows 22. Dutch Power Cows 1 pt. 8,149
  1. Avatar for ti_go_Mars 91. ti_go_Mars Lv 1 1 pt. 9,363
  2. Avatar for DodoBird 92. DodoBird Lv 1 1 pt. 9,358
  3. Avatar for oureion 93. oureion Lv 1 1 pt. 9,353
  4. Avatar for ManVsYard 94. ManVsYard Lv 1 1 pt. 9,353
  5. Avatar for PlagueRat 95. PlagueRat Lv 1 1 pt. 9,349
  6. Avatar for MrZanav 96. MrZanav Lv 1 1 pt. 9,348
  7. Avatar for Zainul0103 97. Zainul0103 Lv 1 1 pt. 9,334
  8. Avatar for ehhan2018 98. ehhan2018 Lv 1 1 pt. 9,326
  9. Avatar for Anton Larin 99. Anton Larin Lv 1 1 pt. 9,325
  10. Avatar for Steven Pletsch 100. Steven Pletsch Lv 1 1 pt. 9,312

Comments