Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,508
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,339
  3. Avatar for freefolder 13. freefolder 1 pt. 9,278
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,820
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,620
  6. Avatar for Androids 16. Androids 1 pt. 8,255
  7. Avatar for DW 2020 17. DW 2020 1 pt. 8,009
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 7,938
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 0
  1. Avatar for ehhan2018 131. ehhan2018 Lv 1 1 pt. 5,719
  2. Avatar for carsonfb 132. carsonfb Lv 1 1 pt. 5,238
  3. Avatar for larry25427 133. larry25427 Lv 1 1 pt. 5,182
  4. Avatar for leethobbit 134. leethobbit Lv 1 1 pt. 5,154
  5. Avatar for Dali En 135. Dali En Lv 1 1 pt. 5,102
  6. Avatar for Piup 136. Piup Lv 1 1 pt. 4,764
  7. Avatar for SiPot2018 137. SiPot2018 Lv 1 1 pt. 4,655
  8. Avatar for sboy171772 138. sboy171772 Lv 1 1 pt. 4,652
  9. Avatar for Alpha221 139. Alpha221 Lv 1 1 pt. 4,082
  10. Avatar for Hollinas 140. Hollinas Lv 1 1 pt. 0

Comments