Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,508
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,339
  3. Avatar for freefolder 13. freefolder 1 pt. 9,278
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,820
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,620
  6. Avatar for Androids 16. Androids 1 pt. 8,255
  7. Avatar for DW 2020 17. DW 2020 1 pt. 8,009
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 7,938
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 0
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 70 pts. 10,040
  2. Avatar for Vinara 12. Vinara Lv 1 68 pts. 10,034
  3. Avatar for pvc78 13. pvc78 Lv 1 65 pts. 10,027
  4. Avatar for crpainter 14. crpainter Lv 1 63 pts. 10,026
  5. Avatar for manu8170 15. manu8170 Lv 1 61 pts. 9,997
  6. Avatar for Sissue 16. Sissue Lv 1 58 pts. 9,963
  7. Avatar for frood66 17. frood66 Lv 1 56 pts. 9,947
  8. Avatar for georg137 18. georg137 Lv 1 54 pts. 9,944
  9. Avatar for nicobul 19. nicobul Lv 1 52 pts. 9,936
  10. Avatar for YeshuaLives 20. YeshuaLives Lv 1 50 pts. 9,936

Comments