Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 70 pts. 10,040
  2. Avatar for Vinara 12. Vinara Lv 1 68 pts. 10,034
  3. Avatar for pvc78 13. pvc78 Lv 1 65 pts. 10,027
  4. Avatar for crpainter 14. crpainter Lv 1 63 pts. 10,026
  5. Avatar for manu8170 15. manu8170 Lv 1 61 pts. 9,997
  6. Avatar for Sissue 16. Sissue Lv 1 58 pts. 9,963
  7. Avatar for frood66 17. frood66 Lv 1 56 pts. 9,947
  8. Avatar for georg137 18. georg137 Lv 1 54 pts. 9,944
  9. Avatar for nicobul 19. nicobul Lv 1 52 pts. 9,936
  10. Avatar for YeshuaLives 20. YeshuaLives Lv 1 50 pts. 9,936

Comments