Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,508
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,339
  3. Avatar for freefolder 13. freefolder 1 pt. 9,278
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,820
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,620
  6. Avatar for Androids 16. Androids 1 pt. 8,255
  7. Avatar for DW 2020 17. DW 2020 1 pt. 8,009
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 7,938
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 0
  1. Avatar for vakobo 21. vakobo Lv 1 48 pts. 9,931
  2. Avatar for reefyrob 22. reefyrob Lv 1 46 pts. 9,927
  3. Avatar for Blipperman 23. Blipperman Lv 1 44 pts. 9,913
  4. Avatar for tyler0911 24. tyler0911 Lv 1 43 pts. 9,911
  5. Avatar for Mike Cassidy 25. Mike Cassidy Lv 1 41 pts. 9,907
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 39 pts. 9,898
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 38 pts. 9,891
  8. Avatar for robgee 28. robgee Lv 1 36 pts. 9,863
  9. Avatar for katling 29. katling Lv 1 35 pts. 9,855
  10. Avatar for guineapig 30. guineapig Lv 1 33 pts. 9,823

Comments