Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815
  1. Avatar for vakobo 21. vakobo Lv 1 48 pts. 9,931
  2. Avatar for reefyrob 22. reefyrob Lv 1 46 pts. 9,927
  3. Avatar for Blipperman 23. Blipperman Lv 1 44 pts. 9,913
  4. Avatar for tyler0911 24. tyler0911 Lv 1 43 pts. 9,911
  5. Avatar for Mike Cassidy 25. Mike Cassidy Lv 1 41 pts. 9,907
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 39 pts. 9,898
  7. Avatar for christioanchauvin 27. christioanchauvin Lv 1 38 pts. 9,891
  8. Avatar for robgee 28. robgee Lv 1 36 pts. 9,863
  9. Avatar for katling 29. katling Lv 1 35 pts. 9,855
  10. Avatar for guineapig 30. guineapig Lv 1 33 pts. 9,823

Comments