Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,508
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,339
  3. Avatar for freefolder 13. freefolder 1 pt. 9,278
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,820
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,620
  6. Avatar for Androids 16. Androids 1 pt. 8,255
  7. Avatar for DW 2020 17. DW 2020 1 pt. 8,009
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 7,938
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 0
  1. Avatar for TastyMunchies 31. TastyMunchies Lv 1 32 pts. 9,822
  2. Avatar for O Seki To 32. O Seki To Lv 1 31 pts. 9,815
  3. Avatar for Marvelz 33. Marvelz Lv 1 29 pts. 9,798
  4. Avatar for Glen B 34. Glen B Lv 1 28 pts. 9,779
  5. Avatar for cbwest 35. cbwest Lv 1 27 pts. 9,773
  6. Avatar for jobo0502 36. jobo0502 Lv 1 26 pts. 9,764
  7. Avatar for silent gene 37. silent gene Lv 1 25 pts. 9,749
  8. Avatar for drumpeter18yrs9yrs 38. drumpeter18yrs9yrs Lv 1 23 pts. 9,743
  9. Avatar for Timo van der Laan 39. Timo van der Laan Lv 1 22 pts. 9,717
  10. Avatar for Threeoak 40. Threeoak Lv 1 21 pts. 9,714

Comments