Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815

  1. Avatar for TastyMunchies 31. TastyMunchies Lv 1 32 pts. 9,822
  2. Avatar for O Seki To 32. O Seki To Lv 1 31 pts. 9,815
  3. Avatar for Marvelz 33. Marvelz Lv 1 29 pts. 9,798
  4. Avatar for Glen B 34. Glen B Lv 1 28 pts. 9,779
  5. Avatar for cbwest 35. cbwest Lv 1 27 pts. 9,773
  6. Avatar for jobo0502 36. jobo0502 Lv 1 26 pts. 9,764
  7. Avatar for silent gene 37. silent gene Lv 1 25 pts. 9,749
  8. Avatar for drumpeter18yrs9yrs 38. drumpeter18yrs9yrs Lv 1 23 pts. 9,743
  9. Avatar for Timo van der Laan 39. Timo van der Laan Lv 1 22 pts. 9,717
  10. Avatar for Threeoak 40. Threeoak Lv 1 21 pts. 9,714

Comments