Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,508
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,339
  3. Avatar for freefolder 13. freefolder 1 pt. 9,278
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,820
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,620
  6. Avatar for Androids 16. Androids 1 pt. 8,255
  7. Avatar for DW 2020 17. DW 2020 1 pt. 8,009
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 7,938
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 0
  1. Avatar for Arne Heessels 71. Arne Heessels Lv 1 4 pts. 9,196
  2. Avatar for navn 72. navn Lv 1 4 pts. 9,156
  3. Avatar for diamonddays 73. diamonddays Lv 1 4 pts. 9,082
  4. Avatar for Rastamasta 74. Rastamasta Lv 1 4 pts. 9,075
  5. Avatar for joaniegirl 75. joaniegirl Lv 1 3 pts. 9,037
  6. Avatar for Flagg65a 76. Flagg65a Lv 1 3 pts. 9,002
  7. Avatar for stomjoh 77. stomjoh Lv 1 3 pts. 8,990
  8. Avatar for MicElephant 78. MicElephant Lv 1 3 pts. 8,981
  9. Avatar for Hellcat6 79. Hellcat6 Lv 1 3 pts. 8,975
  10. Avatar for Squirrely 80. Squirrely Lv 1 2 pts. 8,934

Comments