Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for GENE 433 11. GENE 433 4 pts. 10,394
  2. Avatar for DW 2020 12. DW 2020 3 pts. 10,216
  3. Avatar for Hold My Beer 13. Hold My Beer 2 pts. 10,122
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,900
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,724
  6. Avatar for Deleted group 16. Deleted group pts. 9,628
  7. Avatar for freefolder 17. freefolder 1 pt. 9,583
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 9,490
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,219
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,109
  1. Avatar for RyeSnake 111. RyeSnake Lv 1 1 pt. 9,628
  2. Avatar for 4030_18_Abdelaziz 112. 4030_18_Abdelaziz Lv 1 1 pt. 9,628
  3. Avatar for Altercomp 113. Altercomp Lv 1 1 pt. 9,583
  4. Avatar for ti_go_Mars 114. ti_go_Mars Lv 1 1 pt. 9,569
  5. Avatar for Angelita De Castro 115. Angelita De Castro Lv 1 1 pt. 9,557
  6. Avatar for Philippe_C 116. Philippe_C Lv 1 1 pt. 9,548
  7. Avatar for ManVsYard 117. ManVsYard Lv 1 1 pt. 9,533
  8. Avatar for Crossed Sticks 118. Crossed Sticks Lv 1 1 pt. 9,531
  9. Avatar for hajtogato 119. hajtogato Lv 1 1 pt. 9,513
  10. Avatar for Hellcat6 120. Hellcat6 Lv 1 1 pt. 9,501

Comments