Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for GENE 433 11. GENE 433 4 pts. 10,394
  2. Avatar for DW 2020 12. DW 2020 3 pts. 10,216
  3. Avatar for Hold My Beer 13. Hold My Beer 2 pts. 10,122
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,900
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,724
  6. Avatar for Deleted group 16. Deleted group pts. 9,628
  7. Avatar for freefolder 17. freefolder 1 pt. 9,583
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 9,490
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,219
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,109
  1. Avatar for ac281201 131. ac281201 Lv 1 1 pt. 9,155
  2. Avatar for aspadistra 132. aspadistra Lv 1 1 pt. 9,109
  3. Avatar for lamoille 133. lamoille Lv 1 1 pt. 9,088
  4. Avatar for khendarg 134. khendarg Lv 1 1 pt. 9,062
  5. Avatar for versat82 135. versat82 Lv 1 1 pt. 9,041
  6. Avatar for SiPot2018 136. SiPot2018 Lv 1 1 pt. 9,019
  7. Avatar for Ele25 137. Ele25 Lv 1 1 pt. 8,552
  8. Avatar for bkoep 138. bkoep Lv 1 1 pt. 8,537
  9. Avatar for RockOn 139. RockOn Lv 1 1 pt. 7,793
  10. Avatar for liaolantian 140. liaolantian Lv 1 1 pt. 5,520

Comments