Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for GENE 433 11. GENE 433 4 pts. 10,394
  2. Avatar for DW 2020 12. DW 2020 3 pts. 10,216
  3. Avatar for Hold My Beer 13. Hold My Beer 2 pts. 10,122
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,900
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,724
  6. Avatar for Deleted group 16. Deleted group pts. 9,628
  7. Avatar for freefolder 17. freefolder 1 pt. 9,583
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 9,490
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,219
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,109

  1. Avatar for NinjaGreg 41. NinjaGreg Lv 1 20 pts. 10,541
  2. Avatar for actiasluna 42. actiasluna Lv 1 19 pts. 10,527
  3. Avatar for YeshuaLives 43. YeshuaLives Lv 1 19 pts. 10,520
  4. Avatar for jermainiac 44. jermainiac Lv 1 18 pts. 10,484
  5. Avatar for Marvelz 45. Marvelz Lv 1 17 pts. 10,469
  6. Avatar for katling 46. katling Lv 1 16 pts. 10,468
  7. Avatar for MicElephant 47. MicElephant Lv 1 15 pts. 10,462
  8. Avatar for gdnskye 48. gdnskye Lv 1 15 pts. 10,461
  9. Avatar for tarimo 49. tarimo Lv 1 14 pts. 10,461
  10. Avatar for guineapig 50. guineapig Lv 1 13 pts. 10,458

Comments