Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520
  1. Avatar for RyeSnake 111. RyeSnake Lv 1 1 pt. 9,628
  2. Avatar for 4030_18_Abdelaziz 112. 4030_18_Abdelaziz Lv 1 1 pt. 9,628
  3. Avatar for Altercomp 113. Altercomp Lv 1 1 pt. 9,583
  4. Avatar for ti_go_Mars 114. ti_go_Mars Lv 1 1 pt. 9,569
  5. Avatar for Angelita De Castro 115. Angelita De Castro Lv 1 1 pt. 9,557
  6. Avatar for Philippe_C 116. Philippe_C Lv 1 1 pt. 9,548
  7. Avatar for ManVsYard 117. ManVsYard Lv 1 1 pt. 9,533
  8. Avatar for Crossed Sticks 118. Crossed Sticks Lv 1 1 pt. 9,531
  9. Avatar for hajtogato 119. hajtogato Lv 1 1 pt. 9,513
  10. Avatar for Hellcat6 120. Hellcat6 Lv 1 1 pt. 9,501

Comments