Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,691
  2. Avatar for freefolder 12. freefolder 1 pt. 9,437
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,712
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,710
  1. Avatar for multaq 91. multaq Lv 1 1 pt. 8,798
  2. Avatar for 15SecNut 92. 15SecNut Lv 1 1 pt. 8,774
  3. Avatar for JasperD 93. JasperD Lv 1 1 pt. 8,712
  4. Avatar for zanbato 94. zanbato Lv 1 1 pt. 8,710
  5. Avatar for rezaefar 95. rezaefar Lv 1 1 pt. 8,697
  6. Avatar for rabamino12358 96. rabamino12358 Lv 1 1 pt. 8,691
  7. Avatar for pfirth 97. pfirth Lv 1 1 pt. 8,676
  8. Avatar for Willyanto 98. Willyanto Lv 1 1 pt. 8,519
  9. Avatar for Merf 99. Merf Lv 1 1 pt. 8,430
  10. Avatar for NinguLilium 100. NinguLilium Lv 1 1 pt. 8,413

Comments