Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,691
  2. Avatar for freefolder 12. freefolder 1 pt. 9,437
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,712
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,710
  1. Avatar for JugrenisII 101. JugrenisII Lv 1 1 pt. 8,357
  2. Avatar for asd456 102. asd456 Lv 1 1 pt. 8,317
  3. Avatar for petetrig 103. petetrig Lv 1 1 pt. 8,260
  4. Avatar for otong1 104. otong1 Lv 1 1 pt. 8,245
  5. Avatar for Dantoto 105. Dantoto Lv 1 1 pt. 8,143
  6. Avatar for hajtogato 106. hajtogato Lv 1 1 pt. 8,136
  7. Avatar for Undefined24 107. Undefined24 Lv 1 1 pt. 8,126
  8. Avatar for Eloy_Beltran 108. Eloy_Beltran Lv 1 1 pt. 7,953
  9. Avatar for Greenlee 109. Greenlee Lv 1 1 pt. 7,919
  10. Avatar for lconor 110. lconor Lv 1 1 pt. 7,727

Comments