Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,376
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 10,328
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,080
  4. Avatar for Go Science 4. Go Science 27 pts. 10,047
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,993
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 9,900
  7. Avatar for Contenders 7. Contenders 5 pts. 9,839
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,765
  10. Avatar for Russian team 10. Russian team 1 pt. 9,710
  1. Avatar for Aubade01 11. Aubade01 Lv 1 68 pts. 9,956
  2. Avatar for hpaege 12. hpaege Lv 1 65 pts. 9,922
  3. Avatar for Timo van der Laan 13. Timo van der Laan Lv 1 62 pts. 9,900
  4. Avatar for Skippysk8s 14. Skippysk8s Lv 1 60 pts. 9,865
  5. Avatar for georg137 15. georg137 Lv 1 57 pts. 9,839
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 55 pts. 9,824
  7. Avatar for Blipperman 17. Blipperman Lv 1 52 pts. 9,806
  8. Avatar for jobo0502 18. jobo0502 Lv 1 50 pts. 9,797
  9. Avatar for crpainter 19. crpainter Lv 1 48 pts. 9,794
  10. Avatar for frood66 20. frood66 Lv 1 46 pts. 9,784

Comments