Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,376
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 10,328
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,080
  4. Avatar for Go Science 4. Go Science 27 pts. 10,047
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,993
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 9,900
  7. Avatar for Contenders 7. Contenders 5 pts. 9,839
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,765
  10. Avatar for Russian team 10. Russian team 1 pt. 9,710
  1. Avatar for Dhalion 41. Dhalion Lv 1 16 pts. 9,619
  2. Avatar for Anfinsen_slept_here 42. Anfinsen_slept_here Lv 1 16 pts. 9,615
  3. Avatar for DoctorSockrates 43. DoctorSockrates Lv 1 15 pts. 9,575
  4. Avatar for YeshuaLives 44. YeshuaLives Lv 1 14 pts. 9,538
  5. Avatar for Origami314 45. Origami314 Lv 1 13 pts. 9,535
  6. Avatar for diamonddays 46. diamonddays Lv 1 12 pts. 9,530
  7. Avatar for pvc78 47. pvc78 Lv 1 12 pts. 9,522
  8. Avatar for Aminal88 48. Aminal88 Lv 1 11 pts. 9,515
  9. Avatar for Norrjane 49. Norrjane Lv 1 10 pts. 9,511
  10. Avatar for Altercomp 50. Altercomp Lv 1 10 pts. 9,487

Comments