Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,376
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 10,328
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,080
  4. Avatar for Go Science 4. Go Science 27 pts. 10,047
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,993
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 9,900
  7. Avatar for Contenders 7. Contenders 5 pts. 9,839
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,765
  10. Avatar for Russian team 10. Russian team 1 pt. 9,710
  1. Avatar for Vinara 21. Vinara Lv 1 44 pts. 9,771
  2. Avatar for gdnskye 22. gdnskye Lv 1 42 pts. 9,768
  3. Avatar for O Seki To 23. O Seki To Lv 1 40 pts. 9,765
  4. Avatar for Museka 24. Museka Lv 1 38 pts. 9,754
  5. Avatar for Mike Cassidy 25. Mike Cassidy Lv 1 37 pts. 9,739
  6. Avatar for johnmitch 26. johnmitch Lv 1 35 pts. 9,738
  7. Avatar for guineapig 27. guineapig Lv 1 33 pts. 9,725
  8. Avatar for vakobo 28. vakobo Lv 1 32 pts. 9,710
  9. Avatar for Deleted player 29. Deleted player pts. 9,702
  10. Avatar for nicobul 30. nicobul Lv 1 29 pts. 9,692

Comments