Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,137
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,100
  3. Avatar for Go Science 3. Go Science 49 pts. 10,088
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,086
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,085
  6. Avatar for Beta Folders 6. Beta Folders 14 pts. 10,085
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,047
  8. Avatar for Contenders 8. Contenders 5 pts. 10,045
  9. Avatar for Russian team 9. Russian team 3 pts. 10,037
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,457
  1. Avatar for Willyanto 91. Willyanto Lv 1 1 pt. 8,773
  2. Avatar for Dantoto 92. Dantoto Lv 1 1 pt. 8,688
  3. Avatar for bergie72 93. bergie72 Lv 1 1 pt. 8,678
  4. Avatar for Silvercraft 94. Silvercraft Lv 1 1 pt. 8,641
  5. Avatar for ManVsYard 95. ManVsYard Lv 1 1 pt. 8,619
  6. Avatar for p0emmuzic 96. p0emmuzic Lv 1 1 pt. 8,605
  7. Avatar for harvardman 97. harvardman Lv 1 1 pt. 8,592
  8. Avatar for NinguLilium 98. NinguLilium Lv 1 1 pt. 8,586
  9. Avatar for Tomislaw 99. Tomislaw Lv 1 1 pt. 8,560
  10. Avatar for Noosfera 100. Noosfera Lv 1 1 pt. 8,550

Comments