Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,259
  2. Avatar for Go Science 2. Go Science 71 pts. 10,254
  3. Avatar for Russian team 3. Russian team 49 pts. 10,222
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,208
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 10,165
  6. Avatar for Contenders 6. Contenders 14 pts. 10,153
  7. Avatar for Beta Folders 7. Beta Folders 8 pts. 10,124
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,029
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 9,953
  10. Avatar for HMT heritage 10. HMT heritage 2 pts. 9,917
  1. Avatar for Justin Won 101. Justin Won Lv 1 1 pt. 4,482
  2. Avatar for ScyllaHide 102. ScyllaHide Lv 1 1 pt. 4,434
  3. Avatar for harvardman 103. harvardman Lv 1 1 pt. 3,480
  4. Avatar for Jessica Buuck 104. Jessica Buuck Lv 1 1 pt. 3,410
  5. Avatar for Puttering 105. Puttering Lv 1 1 pt. 3,239
  6. Avatar for 01010011111 106. 01010011111 Lv 1 1 pt. 1,699
  7. Avatar for aspadistra 107. aspadistra Lv 1 1 pt. 0
  8. Avatar for Marvelz 108. Marvelz Lv 1 1 pt. 0
  9. Avatar for Fredor 109. Fredor Lv 1 1 pt. 0
  10. Avatar for buckln 110. buckln Lv 1 1 pt. 0

Comments