Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,259
  2. Avatar for Go Science 2. Go Science 71 pts. 10,254
  3. Avatar for Russian team 3. Russian team 49 pts. 10,222
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,208
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 10,165
  6. Avatar for Contenders 6. Contenders 14 pts. 10,153
  7. Avatar for Beta Folders 7. Beta Folders 8 pts. 10,124
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,029
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 9,953
  10. Avatar for HMT heritage 10. HMT heritage 2 pts. 9,917
  1. Avatar for Willyanto 91. Willyanto Lv 1 1 pt. 7,979
  2. Avatar for xbp 92. xbp Lv 1 1 pt. 7,898
  3. Avatar for Idiotboy 93. Idiotboy Lv 1 1 pt. 7,832
  4. Avatar for RockOn 94. RockOn Lv 1 1 pt. 7,722
  5. Avatar for kentish_alex 95. kentish_alex Lv 1 1 pt. 7,591
  6. Avatar for softbear 96. softbear Lv 1 1 pt. 7,517
  7. Avatar for wozzarelli 97. wozzarelli Lv 1 1 pt. 7,186
  8. Avatar for Guan Jhe 98. Guan Jhe Lv 1 1 pt. 7,009
  9. Avatar for komnor 99. komnor Lv 1 1 pt. 5,940
  10. Avatar for kevin everington 100. kevin everington Lv 1 1 pt. 5,719

Comments