Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,259
  2. Avatar for Go Science 2. Go Science 71 pts. 10,254
  3. Avatar for Russian team 3. Russian team 49 pts. 10,222
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,208
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 10,165
  6. Avatar for Contenders 6. Contenders 14 pts. 10,153
  7. Avatar for Beta Folders 7. Beta Folders 8 pts. 10,124
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,029
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 9,953
  10. Avatar for HMT heritage 10. HMT heritage 2 pts. 9,917
  1. Avatar for boondog 71. boondog Lv 1 1 pt. 9,085
  2. Avatar for Arne Heessels 72. Arne Heessels Lv 1 1 pt. 9,064
  3. Avatar for Hellcat6 73. Hellcat6 Lv 1 1 pt. 9,033
  4. Avatar for stephendl102 74. stephendl102 Lv 1 1 pt. 9,030
  5. Avatar for Tehnologik1 75. Tehnologik1 Lv 1 1 pt. 9,024
  6. Avatar for tarimo 76. tarimo Lv 1 1 pt. 8,983
  7. Avatar for JasperD 77. JasperD Lv 1 1 pt. 8,974
  8. Avatar for rinze 78. rinze Lv 1 1 pt. 8,971
  9. Avatar for momadoc 79. momadoc Lv 1 1 pt. 8,914
  10. Avatar for jausmh 80. jausmh Lv 1 1 pt. 8,894

Comments