Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,259
  2. Avatar for Go Science 2. Go Science 71 pts. 10,254
  3. Avatar for Russian team 3. Russian team 49 pts. 10,222
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,208
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 10,165
  6. Avatar for Contenders 6. Contenders 14 pts. 10,153
  7. Avatar for Beta Folders 7. Beta Folders 8 pts. 10,124
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,029
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 9,953
  10. Avatar for HMT heritage 10. HMT heritage 2 pts. 9,917
  1. Avatar for kitek314_pl 61. kitek314_pl Lv 1 3 pts. 9,292
  2. Avatar for mitarcher 62. mitarcher Lv 1 3 pts. 9,286
  3. Avatar for toshiue 63. toshiue Lv 1 2 pts. 9,256
  4. Avatar for fpc 64. fpc Lv 1 2 pts. 9,204
  5. Avatar for navn 65. navn Lv 1 2 pts. 9,201
  6. Avatar for PeterDav 66. PeterDav Lv 1 2 pts. 9,186
  7. Avatar for rabamino12358 67. rabamino12358 Lv 1 2 pts. 9,180
  8. Avatar for alcor29 68. alcor29 Lv 1 2 pts. 9,136
  9. Avatar for WBarme1234 69. WBarme1234 Lv 1 2 pts. 9,134
  10. Avatar for Artoria2e5 70. Artoria2e5 Lv 1 1 pt. 9,133

Comments