Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,259
  2. Avatar for Go Science 2. Go Science 71 pts. 10,254
  3. Avatar for Russian team 3. Russian team 49 pts. 10,222
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,208
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 10,165
  6. Avatar for Contenders 6. Contenders 14 pts. 10,153
  7. Avatar for Beta Folders 7. Beta Folders 8 pts. 10,124
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,029
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 9,953
  10. Avatar for HMT heritage 10. HMT heritage 2 pts. 9,917
  1. Avatar for nicobul 21. nicobul Lv 1 39 pts. 9,970
  2. Avatar for Skippysk8s 22. Skippysk8s Lv 1 37 pts. 9,968
  3. Avatar for johnmitch 23. johnmitch Lv 1 35 pts. 9,967
  4. Avatar for Steven Pletsch 24. Steven Pletsch Lv 1 33 pts. 9,953
  5. Avatar for O Seki To 25. O Seki To Lv 1 31 pts. 9,917
  6. Avatar for Dhalion 26. Dhalion Lv 1 30 pts. 9,910
  7. Avatar for stomjoh 27. stomjoh Lv 1 28 pts. 9,900
  8. Avatar for jermainiac 28. jermainiac Lv 1 26 pts. 9,897
  9. Avatar for frood66 29. frood66 Lv 1 25 pts. 9,895
  10. Avatar for joremen 30. joremen Lv 1 24 pts. 9,885

Comments