Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,259
  2. Avatar for Go Science 2. Go Science 71 pts. 10,254
  3. Avatar for Russian team 3. Russian team 49 pts. 10,222
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,208
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 10,165
  6. Avatar for Contenders 6. Contenders 14 pts. 10,153
  7. Avatar for Beta Folders 7. Beta Folders 8 pts. 10,124
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,029
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 9,953
  10. Avatar for HMT heritage 10. HMT heritage 2 pts. 9,917
  1. Avatar for jamiexq 51. jamiexq Lv 1 6 pts. 9,558
  2. Avatar for diamonddays 52. diamonddays Lv 1 6 pts. 9,551
  3. Avatar for RyeSnake 53. RyeSnake Lv 1 5 pts. 9,512
  4. Avatar for ManVsYard 54. ManVsYard Lv 1 5 pts. 9,489
  5. Avatar for Museka 55. Museka Lv 1 5 pts. 9,461
  6. Avatar for Pawel Tluscik 56. Pawel Tluscik Lv 1 4 pts. 9,454
  7. Avatar for kludbrook 57. kludbrook Lv 1 4 pts. 9,438
  8. Avatar for alyssa_d 58. alyssa_d Lv 1 4 pts. 9,334
  9. Avatar for abiogenesis 59. abiogenesis Lv 1 3 pts. 9,323
  10. Avatar for pfirth 60. pfirth Lv 1 3 pts. 9,310

Comments