Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,259
  2. Avatar for Go Science 2. Go Science 71 pts. 10,254
  3. Avatar for Russian team 3. Russian team 49 pts. 10,222
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 10,208
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 10,165
  6. Avatar for Contenders 6. Contenders 14 pts. 10,153
  7. Avatar for Beta Folders 7. Beta Folders 8 pts. 10,124
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 10,029
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 9,953
  10. Avatar for HMT heritage 10. HMT heritage 2 pts. 9,917
  1. Avatar for TastyMunchies 31. TastyMunchies Lv 1 22 pts. 9,883
  2. Avatar for robgee 32. robgee Lv 1 21 pts. 9,878
  3. Avatar for Deleted player 33. Deleted player pts. 9,870
  4. Avatar for cbwest 34. cbwest Lv 1 19 pts. 9,864
  5. Avatar for Mike Cassidy 35. Mike Cassidy Lv 1 18 pts. 9,827
  6. Avatar for heather-1 36. heather-1 Lv 1 16 pts. 9,814
  7. Avatar for pvc78 37. pvc78 Lv 1 15 pts. 9,810
  8. Avatar for Phyx 38. Phyx Lv 1 15 pts. 9,778
  9. Avatar for aznarog 39. aznarog Lv 1 14 pts. 9,767
  10. Avatar for Deleted player 40. Deleted player pts. 9,767

Comments