Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,789
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 12,695
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 12,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 12,556
  5. Avatar for Go Science 5. Go Science 29 pts. 12,460
  6. Avatar for Contenders 6. Contenders 20 pts. 12,414
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,381
  8. Avatar for Russian team 8. Russian team 9 pts. 12,197
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 12,051
  10. Avatar for Hold My Beer 10. Hold My Beer 4 pts. 11,905
  1. Avatar for WBarme1234 61. WBarme1234 Lv 1 5 pts. 11,516
  2. Avatar for Pawel Tluscik 62. Pawel Tluscik Lv 1 5 pts. 11,512
  3. Avatar for Kiwi2kiwi 63. Kiwi2kiwi Lv 1 5 pts. 11,501
  4. Avatar for hanyanbo98 64. hanyanbo98 Lv 1 5 pts. 11,445
  5. Avatar for JasperD 65. JasperD Lv 1 4 pts. 11,424
  6. Avatar for boondog 66. boondog Lv 1 4 pts. 11,416
  7. Avatar for RyeSnake 67. RyeSnake Lv 1 4 pts. 11,410
  8. Avatar for abiogenesis 68. abiogenesis Lv 1 4 pts. 11,401
  9. Avatar for dahast.de 69. dahast.de Lv 1 3 pts. 11,376
  10. Avatar for joremen 70. joremen Lv 1 3 pts. 11,369

Comments