Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,789
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 12,695
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 12,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 12,556
  5. Avatar for Go Science 5. Go Science 29 pts. 12,460
  6. Avatar for Contenders 6. Contenders 20 pts. 12,414
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,381
  8. Avatar for Russian team 8. Russian team 9 pts. 12,197
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 12,051
  10. Avatar for Hold My Beer 10. Hold My Beer 4 pts. 11,905
  1. Avatar for jamiexq 71. jamiexq Lv 1 3 pts. 11,347
  2. Avatar for rabamino12358 72. rabamino12358 Lv 1 3 pts. 11,318
  3. Avatar for Hellcat6 73. Hellcat6 Lv 1 3 pts. 11,315
  4. Avatar for stephendl102 74. stephendl102 Lv 1 2 pts. 11,309
  5. Avatar for rinze 75. rinze Lv 1 2 pts. 11,283
  6. Avatar for alyssa_d 76. alyssa_d Lv 1 2 pts. 11,251
  7. Avatar for softbear 77. softbear Lv 1 2 pts. 11,250
  8. Avatar for Arne Heessels 78. Arne Heessels Lv 1 2 pts. 11,245
  9. Avatar for aspadistra 79. aspadistra Lv 1 2 pts. 11,218
  10. Avatar for Deleted player 80. Deleted player pts. 11,211

Comments