Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,789
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 12,695
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 12,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 12,556
  5. Avatar for Go Science 5. Go Science 29 pts. 12,460
  6. Avatar for Contenders 6. Contenders 20 pts. 12,414
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,381
  8. Avatar for Russian team 8. Russian team 9 pts. 12,197
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 12,051
  10. Avatar for Hold My Beer 10. Hold My Beer 4 pts. 11,905
  1. Avatar for carsonfb 41. carsonfb Lv 1 17 pts. 11,837
  2. Avatar for jausmh 42. jausmh Lv 1 16 pts. 11,827
  3. Avatar for martin.kendig@verizon.net 43. martin.kendig@verizon.net Lv 1 15 pts. 11,820
  4. Avatar for jermainiac 44. jermainiac Lv 1 15 pts. 11,770
  5. Avatar for Deleted player 45. Deleted player 14 pts. 11,751
  6. Avatar for gurch 46. gurch Lv 1 13 pts. 11,736
  7. Avatar for kitek314_pl 47. kitek314_pl Lv 1 12 pts. 11,729
  8. Avatar for altejoh 48. altejoh Lv 1 12 pts. 11,692
  9. Avatar for Museka 49. Museka Lv 1 11 pts. 11,681
  10. Avatar for Cloudy101 50. Cloudy101 Lv 1 11 pts. 11,661

Comments