Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,200
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 11,167
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,125
  4. Avatar for Go Science 4. Go Science 36 pts. 11,118
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 11,076
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 11,073
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 11,029
  8. Avatar for Contenders 8. Contenders 6 pts. 10,990
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,989
  10. Avatar for Russian team 10. Russian team 2 pts. 10,855
  1. Avatar for PeterDav 51. PeterDav Lv 1 7 pts. 10,403
  2. Avatar for ComputerMage 52. ComputerMage Lv 1 6 pts. 10,337
  3. Avatar for Altercomp 53. Altercomp Lv 1 6 pts. 10,301
  4. Avatar for vuvuvu 54. vuvuvu Lv 1 5 pts. 10,301
  5. Avatar for Glen B 55. Glen B Lv 1 5 pts. 10,287
  6. Avatar for gurch 56. gurch Lv 1 5 pts. 10,247
  7. Avatar for jausmh 57. jausmh Lv 1 4 pts. 10,118
  8. Avatar for libellule 58. libellule Lv 1 4 pts. 10,021
  9. Avatar for alyssa_d 59. alyssa_d Lv 1 4 pts. 10,020
  10. Avatar for rinze 60. rinze Lv 1 3 pts. 10,017

Comments