Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,200
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 11,167
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,125
  4. Avatar for Go Science 4. Go Science 36 pts. 11,118
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 11,076
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 11,073
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 11,029
  8. Avatar for Contenders 8. Contenders 6 pts. 10,990
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,989
  10. Avatar for Russian team 10. Russian team 2 pts. 10,855
  1. Avatar for silent gene 21. silent gene Lv 1 40 pts. 10,979
  2. Avatar for Idiotboy 22. Idiotboy Lv 1 38 pts. 10,933
  3. Avatar for diamonddays 23. diamonddays Lv 1 36 pts. 10,928
  4. Avatar for vakobo 24. vakobo Lv 1 34 pts. 10,855
  5. Avatar for anthion 25. anthion Lv 1 32 pts. 10,850
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 31 pts. 10,833
  7. Avatar for guineapig 27. guineapig Lv 1 29 pts. 10,828
  8. Avatar for nicobul 28. nicobul Lv 1 27 pts. 10,814
  9. Avatar for kitek314_pl 29. kitek314_pl Lv 1 26 pts. 10,808
  10. Avatar for Phyx 30. Phyx Lv 1 25 pts. 10,793

Comments