Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 10,728
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,719
  3. Avatar for Go Science 3. Go Science 47 pts. 10,696
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,643
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,633
  6. Avatar for Contenders 6. Contenders 11 pts. 10,561
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 10,532
  8. Avatar for Russian team 8. Russian team 4 pts. 10,470
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 10,466
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,439
  1. Avatar for frood66 31. frood66 Lv 1 23 pts. 10,449
  2. Avatar for Threeoak 32. Threeoak Lv 1 22 pts. 10,444
  3. Avatar for Timo van der Laan 33. Timo van der Laan Lv 1 21 pts. 10,439
  4. Avatar for georg137 34. georg137 Lv 1 20 pts. 10,434
  5. Avatar for Museka 35. Museka Lv 1 18 pts. 10,397
  6. Avatar for Deleted player 36. Deleted player pts. 10,394
  7. Avatar for Norrjane 37. Norrjane Lv 1 16 pts. 10,374
  8. Avatar for jausmh 38. jausmh Lv 1 15 pts. 10,371
  9. Avatar for MicElephant 39. MicElephant Lv 1 15 pts. 10,369
  10. Avatar for silent gene 40. silent gene Lv 1 14 pts. 10,366

Comments