Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 10,728
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,719
  3. Avatar for Go Science 3. Go Science 47 pts. 10,696
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,643
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,633
  6. Avatar for Contenders 6. Contenders 11 pts. 10,561
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 10,532
  8. Avatar for Russian team 8. Russian team 4 pts. 10,470
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 10,466
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,439
  1. Avatar for stomjoh 41. stomjoh Lv 1 13 pts. 10,363
  2. Avatar for aznarog 42. aznarog Lv 1 12 pts. 10,350
  3. Avatar for Anfinsen_slept_here 43. Anfinsen_slept_here Lv 1 11 pts. 10,328
  4. Avatar for 181818 44. 181818 Lv 1 11 pts. 10,303
  5. Avatar for manu8170 45. manu8170 Lv 1 10 pts. 10,284
  6. Avatar for diamonddays 46. diamonddays Lv 1 9 pts. 10,236
  7. Avatar for vuvuvu 47. vuvuvu Lv 1 9 pts. 10,232
  8. Avatar for PeterDav 48. PeterDav Lv 1 8 pts. 10,219
  9. Avatar for andromeda72 49. andromeda72 Lv 1 8 pts. 10,192
  10. Avatar for cbwest 50. cbwest Lv 1 7 pts. 10,138

Comments