Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,893
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 10,851
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,843
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 10,789
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 10,755
  6. Avatar for Contenders 6. Contenders 22 pts. 10,736
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,694
  8. Avatar for Russian team 8. Russian team 11 pts. 10,692
  9. Avatar for The Daydreamers 9. The Daydreamers 7 pts. 10,515
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 10,465
  1. Avatar for cobaltteal 61. cobaltteal Lv 1 3 pts. 10,188
  2. Avatar for Aminal88 62. Aminal88 Lv 1 3 pts. 10,156
  3. Avatar for Pawel Tluscik 63. Pawel Tluscik Lv 1 3 pts. 10,144
  4. Avatar for Arne Heessels 64. Arne Heessels Lv 1 3 pts. 10,078
  5. Avatar for JasperD 65. JasperD Lv 1 2 pts. 10,063
  6. Avatar for pfirth 66. pfirth Lv 1 2 pts. 10,043
  7. Avatar for Willyanto 67. Willyanto Lv 1 2 pts. 10,031
  8. Avatar for Ikuso 68. Ikuso Lv 1 2 pts. 10,026
  9. Avatar for Keresto 69. Keresto Lv 1 2 pts. 9,986
  10. Avatar for georg137 70. georg137 Lv 1 2 pts. 9,975

Comments