Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,709
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,702
  3. Avatar for Russian team 3. Russian team 47 pts. 10,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,514
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,417
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,313
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 10,306
  8. Avatar for Contenders 8. Contenders 4 pts. 10,215
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,201
  10. Avatar for Team New Zealand 10. Team New Zealand 1 pt. 10,105

  1. Avatar for sushanth1710 101. sushanth1710 Lv 1 1 pt. 8,411
  2. Avatar for Melo78 102. Melo78 Lv 1 1 pt. 8,385
  3. Avatar for krstiger 103. krstiger Lv 1 1 pt. 8,376
  4. Avatar for sdrft1 104. sdrft1 Lv 1 1 pt. 8,330
  5. Avatar for BeImmie 105. BeImmie Lv 1 1 pt. 8,293
  6. Avatar for demeter900 106. demeter900 Lv 1 1 pt. 8,284
  7. Avatar for keuumar 107. keuumar Lv 1 1 pt. 8,275
  8. Avatar for Anamfija 108. Anamfija Lv 1 1 pt. 8,249
  9. Avatar for russian2163 109. russian2163 Lv 1 1 pt. 8,233
  10. Avatar for Noosfera 110. Noosfera Lv 1 1 pt. 8,212

Comments