Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,709
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,702
  3. Avatar for Russian team 3. Russian team 47 pts. 10,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,514
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,417
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,313
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 10,306
  8. Avatar for Contenders 8. Contenders 4 pts. 10,215
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,201
  10. Avatar for Team New Zealand 10. Team New Zealand 1 pt. 10,105

  1. Avatar for sersenlla 111. sersenlla Lv 1 1 pt. 8,130
  2. Avatar for sarevok 112. sarevok Lv 1 1 pt. 8,110
  3. Avatar for emtonsti 113. emtonsti Lv 1 1 pt. 7,953
  4. Avatar for 21ahlfeldc 114. 21ahlfeldc Lv 1 1 pt. 7,893
  5. Avatar for jimmy Cashew 115. jimmy Cashew Lv 1 1 pt. 7,756
  6. Avatar for k3t3v4n 116. k3t3v4n Lv 1 1 pt. 7,745
  7. Avatar for Elandru2 117. Elandru2 Lv 1 1 pt. 7,648
  8. Avatar for iancu 118. iancu Lv 1 1 pt. 7,605
  9. Avatar for crazy a tai 119. crazy a tai Lv 1 1 pt. 7,605
  10. Avatar for 01010011111 120. 01010011111 Lv 1 1 pt. 6,580

Comments