Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,024
  2. Avatar for HMT heritage 2. HMT heritage 73 pts. 10,022
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 9,982
  4. Avatar for Go Science 4. Go Science 36 pts. 9,865
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,767
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,765
  7. Avatar for Hold My Beer 7. Hold My Beer 10 pts. 9,688
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 9,585
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 4 pts. 9,574
  10. Avatar for Russian team 10. Russian team 2 pts. 9,571
  1. Avatar for alwen 71. alwen Lv 1 2 pts. 9,253
  2. Avatar for momadoc 72. momadoc Lv 1 2 pts. 9,235
  3. Avatar for Hellcat6 73. Hellcat6 Lv 1 2 pts. 9,229
  4. Avatar for Pawel Tluscik 74. Pawel Tluscik Lv 1 2 pts. 9,213
  5. Avatar for gurch 75. gurch Lv 1 2 pts. 9,209
  6. Avatar for rinze 76. rinze Lv 1 1 pt. 9,170
  7. Avatar for pfirth 77. pfirth Lv 1 1 pt. 9,148
  8. Avatar for haabermaaster 78. haabermaaster Lv 1 1 pt. 9,118
  9. Avatar for jamiexq 79. jamiexq Lv 1 1 pt. 9,107
  10. Avatar for Arne Heessels 80. Arne Heessels Lv 1 1 pt. 9,100

Comments