Placeholder image of a protein
Icon representing a puzzle

1757: Unsolved De-novo Freestyle 157

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
November 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PEKIDRYMDKLEKELRKVTKDEDLLRKIKEKLKEMKKRIKNEEVILILLILILMDVRKKS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,024
  2. Avatar for HMT heritage 2. HMT heritage 73 pts. 10,022
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 9,982
  4. Avatar for Go Science 4. Go Science 36 pts. 9,865
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 9,767
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,765
  7. Avatar for Hold My Beer 7. Hold My Beer 10 pts. 9,688
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 9,585
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 4 pts. 9,574
  10. Avatar for Russian team 10. Russian team 2 pts. 9,571
  1. Avatar for deathbat_87 111. deathbat_87 Lv 1 1 pt. 6,988
  2. Avatar for jonathanh 112. jonathanh Lv 1 1 pt. 6,598
  3. Avatar for Barfbag 113. Barfbag Lv 1 1 pt. 6,372
  4. Avatar for Mardukai 114. Mardukai Lv 1 1 pt. 6,301
  5. Avatar for Yali Ci 115. Yali Ci Lv 1 1 pt. 5,913
  6. Avatar for frostschutz 116. frostschutz Lv 1 1 pt. 5,704
  7. Avatar for Harrison_P 117. Harrison_P Lv 1 1 pt. 5,098
  8. Avatar for Quintivium 118. Quintivium Lv 1 1 pt. 5,004
  9. Avatar for 01010011111 119. 01010011111 Lv 1 1 pt. 4,910
  10. Avatar for libellule 120. libellule Lv 1 1 pt. 0

Comments