Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Team New Zealand 11. Team New Zealand 2 pts. 10,145
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,112
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 10,108
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,976
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 9,864
  6. Avatar for SETI.Germany 16. SETI.Germany 1 pt. 9,413
  7. Avatar for IB Bio 18. IB Bio 1 pt. 4,734

  1. Avatar for BurtHarris 101. BurtHarris Lv 1 1 pt. 9,422
  2. Avatar for aendgraend 102. aendgraend Lv 1 1 pt. 9,413
  3. Avatar for _Cyber_ 103. _Cyber_ Lv 1 1 pt. 9,388
  4. Avatar for SiliconDioxide 104. SiliconDioxide Lv 1 1 pt. 9,360
  5. Avatar for harvardman 105. harvardman Lv 1 1 pt. 9,347
  6. Avatar for Bithalbierer 106. Bithalbierer Lv 1 1 pt. 9,344
  7. Avatar for perfideas 107. perfideas Lv 1 1 pt. 9,315
  8. Avatar for abda bdu 109. abda bdu Lv 1 1 pt. 9,266
  9. Avatar for katiekt94 110. katiekt94 Lv 1 1 pt. 9,260

Comments